celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Hot buffet

Duck - Parsley root

Ingredients

Duck confit 28% (duck leg 97% (Belgium), water, salt, sugar, white pepper, garlic, shallot), parsley root 19%, EGG, MILK, WHEAT flour, fresh pasteurised CREAM, margarine, garlic, fresh flat-leaf parsley 2%, olive oil, salt.

Allergens

  • Eggs
  • Gluten
  • Milk

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 431kcal
    22%
  • Total fat 26g
    38%
  • Saturated fatty acids 11g
    57%
  • Glucid 23g
    9%
  • Sugar 5g
    6%
  • Protein 25g
    50%
  • Salt 1g
    15%
  • FA 2g
    6%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

For all tastes

Our dishes are mainly based on vegetables, of local origin and season, which are at the heart of our recipes. Quality meat or fish sometimes accompanies them, in order to offer a wide variety for all tastes. All our breads are organic and cooked fresh every day. Our chicken comes from responsible farming and we outlaw battery-raised eggs. Our cod comes from a certified sustainable fishing circuit. All of our dairy products are organic. Our coffee is organic and fair trade.