celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-downaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3vision
Ready meals

Paimpol**

MSC** cod, organic* carrot and green lentils, ginger and turmeric emulsion

Ingredients

Carrot mousseline 50% (carrot, potato, onion, salt, rapeseed oil, pepper), green lentils 18%, MSC** COD 18%, pickle sauce 9% (CELERIAC, cauliflower, water, pickle marinade (vinegar (SULPHITE) sugar, olive oil, MUSTARD, turmeric, ginger), rapeseed oil, onion, potato), samphire, spinach, salt, pepper. **The codfish in this product comes from a fishery that has been independently certified to the MSC’s standard for a well-managed and sustainable fishery. www.msc.org

Allergens

  • Celery
  • Fish
  • Mustard
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 218kcal
    11%
  • Total fat 5g
    8%
  • Saturated fatty acids 1g
    3%
  • Glucid 22g
    9%
  • Sugar 6g
    7%
  • Protein 21g
    42%
  • Salt 2g
    38%
  • FA 7g
    29%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Gluten free recipes

Our recipes are made from gluten-free ingredients. However, traces of gluten may remain in certain preparations following preparation in our kitchens of other products with gluten. EXKi offers a wide range of dishes, hot and cold, labelled 'gluten-free', and indicated by the symbol of a crossed-out wheat sheaf.