celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Boost your day

Scottish

Smoked salmon trout, scrambled eggs

Ingredients

EGG 63% (EGG, water, salt, acidifier: citric acid, acetic acid), carrot vinaigrette 23% (carrot, rapeseed oil, red wine vinegar (red wine vinegar, preservative: potassium biSULPHITE), salt, pepper), smoked salmon TROUT 12,5% (TROUT, salt), parsley, black SESAME seed, salt, pepper

Allergens

  • Eggs
  • Fish
  • Sesame
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 270kcal
    14%
  • Total fat 21g
    30%
  • Saturated fatty acids 4g
    19%
  • Glucid 2g
    1%
  • Sugar 2g
    2%
  • Protein 19g
    38%
  • Salt 3g
    43%
  • FA 1g
    3%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Gluten free recipes

Our recipes are made from gluten-free ingredients. However, traces of gluten may remain in certain preparations following preparation in our kitchens of other products with gluten. EXKi offers a wide range of dishes, hot and cold, labelled 'gluten-free', and indicated by the symbol of a crossed-out wheat sheaf.