celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Ready meals

Casablanca

Rice duo, falafel, oriental aubergine compote

Ingredients

Organic* rice 48,5%, aubergine compote 27% (aubergine, red pepper, onion, organic* tomato sauce, olive oil, salt, spices: raz el hanout (CELERY), pepper, black pepper, cayenne pepper), falafel 14% (water, chickpeas, vegetable oil (SOYA or/and rapeseed), onion flakes, bread-crumb (WHEAT flour, salt, yeast), bulgur (WHEAT), thickening agent (E1412), spices, dried onion, garlic, dill, parsley, CELERY, starch, dextrose, maltodextrine, flavour enhancer (E621), salt, yeast, cornstarch, acidity regulators (E450, E500)), onion 5%, raisins 3% (grapes, cottonseed oil), olive oil, turmenic, coriander, cumin, salt, pepper.

Allergens

  • Celery
  • Gluten
  • Soya

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 419kcal
    21%
  • Total fat 11g
    16%
  • Saturated fatty acids 2g
    10%
  • Glucid 74g
    28%
  • Sugar 9g
    10%
  • Protein 12g
    24%
  • Salt 2g
    33%
  • FA 7g
    29%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegan recipes

Our vegan recipes are 100% vegetable, without animal products or by-products of animal origin. They are easily recognisable by their dark green 'Vegan ' pictogram. Our goal is to offer a full and varied range, and to offer food alternatives for all.