celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Hot buffet

Cauliflower - Red lentils

Cauliflower - Red lentils

Ingredients

Cauliflower 27%, red lentils 16%, WHEAT flour, EGGS, fresh pasteurised CREAM 35% fat, MILK, tomato base (tomato pulpo, tomato concentrate, sunflower oil, carrot, onion, CELERY, salt, sugar, herbs), margarine, onion, fresh coriander, curry paste (coriander, paprika, turmeric, fenugreek, fennel, cinnamon, ginger, tamarind, MUSTARD, garlic), salt, garlic, black pepper, olive oil, rice oil.

Allergens

  • Celery
  • Eggs
  • Gluten
  • Milk
  • Mustard

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 320kcal
    16%
  • Total fat 14g
    19%
  • Saturated fatty acids 6g
    32%
  • Glucid 35g
    14%
  • Sugar 2g
    3%
  • Protein 15g
    29%
  • Salt 1g
    17%
  • FA 3g
    12%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.