celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Hot buffet

Yucatan

Pumpkin lasagne with cheese

Ingredients

Pumpkin lasagne 97% (pumpkin puree 58% (pumpkin, carrot, CELERIAC, grated cheese (pasteurised MILK, salt, rennet, preservative: EGG lysozym), ricotta (pasteurised MILK, CREAM, salt, citric acid)), vegetables 29% (carrot, pumpkin, CELERIAC, sun-dried tomato, pepper, salt), lasagne 10% (WHEAT, EGG)), cheese 3% (raw MILK, salt, lactic ferments, animal rennet).

Allergens

  • Celery
  • Eggs
  • Gluten
  • Milk

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 210kcal
    11%
  • Total fat 7g
    10%
  • Saturated fatty acids 4g
    19%
  • Glucid 22g
    8%
  • Sugar 9g
    10%
  • Protein 11g
    22%
  • Salt 2g
    35%
  • FA 7g
    29%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.