celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Boost your day

Jumper Pineapple - Mango

Pineapple, organic* yogurt, organic* cereals, mango coulis

Ingredients

Organic* low-fat YOGURT 42% (pasteurised MILK, cultures), pineapple 27%, organic* crunchy muesli with cranberries 15% (OAT, WHEAT, BARLEY, ALMOND, SESAME), organic* raisins, mango coulis, organic* pumpkin seeds. *66% of the ingredients are sourced from organic farming. Certified by Certyis BE-BIO-01

Allergens

  • Gluten
  • Milk
  • Nuts
  • Sesame

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 217kcal
    11%
  • Total fat 4g
    6%
  • Saturated fatty acids 1g
    5%
  • Glucid 35g
    14%
  • Sugar 22g
    24%
  • Protein 7g
    14%
  • Salt 0g
    6%
  • FA 4g
    16%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.