celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Organic baguette

Adelin

Organic* baguette, roasted Vita® chicken, mozzarella, mushroom, basil pesto

Ingredients

Organic* baguette 44% (WHEAT, BARLEY, SOYA), roasted Vita® chicken 19% (Belgium), mozzarella 11,5% (raw MILK, animal rennet), basil pesto 7,7% (GRANA PADANO, (raw MILK, animal rennet, EGG), ALMOND), mushroom 8%, curly endive, MUSTARD-honey dressing (MUSTARD, SULPHITE). *44% of the agricultural ingredients are sourced from organic farming. Certified by Certisys BE-BIO-01

Allergens

  • Eggs
  • Gluten
  • Milk
  • Mustard
  • Nuts
  • Soya
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 562kcal
    28%
  • Total fat 24g
    34%
  • Saturated fatty acids 4g
    22%
  • Glucid 56g
    22%
  • Sugar 2g
    2%
  • Protein 29g
    58%
  • Salt 3g
    43%
  • FA 2g
    9%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

For all tastes

Our dishes are mainly based on vegetables, of local origin and season, which are at the heart of our recipes. Quality meat or fish sometimes accompanies them, in order to offer a wide variety for all tastes. All our breads are organic and cooked fresh every day. Our chicken comes from responsible farming and we outlaw battery-raised eggs. Our cod comes from a certified sustainable fishing circuit. All of our dairy products are organic. Our coffee is organic and fair trade.