celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Organic baguette

Alvar

Baguette, Emmental cheese, tomato, eggs mimosa

Ingredients

Baguette 39% (WHEAT, BARLEY, SOYA), EGGS mimosa 15% (MILK, CELERY, MUSTARD), EMMENTAL cheese 13% (pasteurised MILK, microbial rennet), cucumber 10%, tomato 15%, endive 6%, honey-MUSTARD vinaigrette (SULPHITE) 2%.

Allergens

  • Celery
  • Eggs
  • Gluten
  • Milk
  • Mustard
  • Soya
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 526kcal
    26%
  • Total fat 20g
    29%
  • Saturated fatty acids 9g
    46%
  • Glucid 58g
    22%
  • Sugar 3g
    4%
  • Protein 27g
    54%
  • Salt 2g
    30%
  • FA 3g
    11%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.