celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Large salads

La Napoule

Vita® roasted chicken, spelt, sun-dried tomato, cucumber, grape

Ingredients

Semolina 41% (WHEAT semolina, rapeseed oil), lettuce 14%, roasted Vita® chicken 10% (chicken (Belgium), salt, dextrose, spices, flavouring), cucumber 9%, CELERY 9%, broccoli 7%, dried grapes 4% (grapes, cottonseed oil), sun-dried tomato 4% (tomato, sunflower oil, salt, acidifiant : citric acid), arugula, coriander, fennel, cumin, salt, pepper.

Allergens

  • Celery
  • Gluten

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 345kcal
    17%
  • Total fat 14g
    20%
  • Saturated fatty acids 1g
    6%
  • Glucid 38g
    15%
  • Sugar 11g
    12%
  • Protein 14g
    28%
  • Salt 2g
    29%
  • FA 5g
    21%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

For all tastes

Our dishes are mainly based on vegetables, of local origin and season, which are at the heart of our recipes. Quality meat or fish sometimes accompanies them, in order to offer a wide variety for all tastes. All our breads are organic and cooked fresh every day. Our chicken comes from responsible farming and we outlaw battery-raised eggs. Our cod comes from a certified sustainable fishing circuit. All of our dairy products are organic. Our coffee is organic and fair trade.