celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Fruit&Tea

Pina Coco

Pineapple, organic* and Fairtrade coconut milk, fresh mint

Ingredients

Pineapple, organic* and Fairtrade coconut milk, fresh mint

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 295kcal
    15%
  • Total fat 9g
    14%
  • Saturated fatty acids 8g
    42%
  • Glucid 51g
    20%
  • Sugar 49g
    54%
  • Protein 2g
    4%
  • Salt 0g
    0%
  • FA 5g
    20%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegan recipes

Our vegan recipes are 100% vegetable, without animal products or by-products of animal origin. They are easily recognisable by their dark green 'Vegan ' pictogram. Our goal is to offer a full and varied range, and to offer food alternatives for all.