celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-downaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3vision
Cold starters

Capri

Linguini, Grana Padano, cooked ham without added nitrite, arugula

Ingredients

Linguine 71% (WHEAT, rapeseed oil), cooked ham without added nitrite 9% (pork meat 96% (Belgium), salt, dextrose, vegetables extract, flavouring, herbs extract), rapeseed oil, arugula, Grana Padano 3% (raw MILK (Italy), salt, animal rennet, preservative: EGG lysozyme), balsamic vinegar (wine vinegar, must of concentrated grapes (SULPHITE)), cheese (MILK, salt, rennet, preservative : EGG lysozyme), salt, pepper.

Allergens

  • Eggs
  • Gluten
  • Milk
  • Soya
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 473kcal
    24%
  • Total fat 25g
    36%
  • Saturated fatty acids 4g
    18%
  • Glucid 45g
    17%
  • Sugar 2g
    2%
  • Protein 16g
    31%
  • Salt 2g
    26%
  • FA 2g
    9%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

For all tastes

Our dishes are mainly based on vegetables, of local origin and season, which are at the heart of our recipes. Quality meat or fish sometimes accompanies them, in order to offer a wide variety for all tastes. All our breads are organic and cooked fresh every day. Our chicken comes from responsible farming and we outlaw battery-raised eggs. Our cod comes from a certified sustainable fishing circuit. All of our dairy products are organic. Our coffee is organic and fair trade.