celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Pies

Merveilleux

Ingredients

CREAM, dark chocolate flakes (SOYA), meringue (sugar, EGG whites), cocoa butter, white chocolat (MILK, SOYA), powdered sugar, cacao powder.

Allergens

  • Eggs
  • Milk
  • Soya

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 546kcal
    27%
  • Total fat 40g
    57%
  • Saturated fatty acids 26g
    130%
  • Glucid 41g
    16%
  • Sugar 40g
    45%
  • Protein 4g
    8%
  • Salt 0g
    3%
  • FA 2g
    8%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.