celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Mini desserts

Organic* pastéis de nata

Organic* pastéis de nata

Ingredients

MILK, CREAM, WHEAT flour, EGG yolk, cane sugar, vegetable margarine, corn starch, sea-salt.

Allergens

  • Eggs
  • Gluten
  • Milk

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 192kcal
    10%
  • Total fat 23g
    33%
  • Saturated fatty acids 6g
    30%
  • Glucid 20g
    8%
  • Sugar 8g
    9%
  • Protein 11g
    23%
  • Salt 0g
    5%
  • FA 0g
    1%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.