celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Spring Rolls

Chihiro

Spring rolls with cabbage and rice vermicelli, organic* tofu, sesame seeds

Ingredients

Mix cabbage with vermicelli 63% (rice vermicelli, Chinese cabbage, red cabbage, green cabbage, kale, red onion pickles (SULPHITE), Thaï vinaigrette (SOYA, SESAME), organic* SESAME seeds), rice paper wraps 13%, organic* tofu 13% (SOYA), sauce (organic* Tamari (SOYA), orange juice). *18,5% of the ingredients are sourced from organic farming. Certified by Certysis BE-BIO-01

Allergens

  • Sesame
  • Soya
  • Sulphites

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 195kcal
    10%
  • Total fat 9g
    13%
  • Saturated fatty acids 1g
    6%
  • Glucid 21g
    8%
  • Sugar 3g
    3%
  • Protein 6g
    12%
  • Salt 2g
    40%
  • FA 2g
    8%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Gluten free recipes

Our recipes are made from gluten-free ingredients. However, traces of gluten may remain in certain preparations following preparation in our kitchens of other products with gluten. EXKi offers a wide range of dishes, hot and cold, labelled 'gluten-free', and indicated by the symbol of a crossed-out wheat sheaf.