celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Energy salad

Everest - Energy Salad

Organic* red lentils and jasmine rice, beetroot hummus, organic* salad, cashew nuts

Ingredients

Beetroot hummus 33% (chickpeas, organic* beetroot, rapeseed oil, lemon juice, parsley, cumin seeds, garlic, salt, pepper), red lentils 20% (organic* red lentils, rapeseed oil), organic* jasmine rice 12%, organic* beetroot 8%, organic* carrot 7%, dried dates 4% (date 95%, rice flour 5%), CASHEW NUTS 3%, rapeseed oil, parsley, MUSTARD seeds, lemon juice, salt, pepper. *57,3% of the ingredients are sourced from organic farming. Certified by Certysis BE-BIO-01

Allergens

  • Mustard
  • Nuts

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 540kcal
    27%
  • Total fat 34g
    49%
  • Saturated fatty acids 3g
    16%
  • Glucid 41g
    16%
  • Sugar 14g
    16%
  • Protein 13g
    26%
  • Salt 3g
    50%
  • FA 8g
    34%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegan recipes

Our vegan recipes are 100% vegetable, without animal products or by-products of animal origin. They are easily recognisable by their dark green 'Vegan ' pictogram. Our goal is to offer a full and varied range, and to offer food alternatives for all.