celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Energy salad

McKinley - Energy salad

Organic* quinoa, hummus with mushrooms, celery, mushroom, cranberry, hazelnut

Ingredients

Hummus with mushrooms 33% (chickpea, CELERY, mushroom, olive oil, rapeseed oil, organic* SESAME oil, lemon juice, salt, garlic, cayenne pepper), quinoa 25% (organic* quinoa, salt), cooked CELERY 8% (CELERY, salt, pepper), mushroom 7%, chard 5%, dried cranberries 5% (cranberry, sugar, sunflower oil), rapeseed oil, apple 3% (appel, antioxidant: E330), onion, lemon juice, HAZELNUT 2%, chives, salt, pepper. *25,7% of the ingredients are sourced from organic farming. Certified by Certysis BE-BIO-01

Allergens

  • Celery
  • Nuts
  • Sesame

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 516kcal
    26%
  • Total fat 33g
    47%
  • Saturated fatty acids 3g
    16%
  • Glucid 39g
    15%
  • Sugar 25g
    28%
  • Protein 11g
    22%
  • Salt 3g
    50%
  • FA 8g
    32%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Gluten free recipes

Our recipes are made from gluten-free ingredients. However, traces of gluten may remain in certain preparations following preparation in our kitchens of other products with gluten. EXKi offers a wide range of dishes, hot and cold, labelled 'gluten-free', and indicated by the symbol of a crossed-out wheat sheaf.