celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Vegetables desserts

Pear - Parsnip

Chia pudding, compote of pear and parsnip

Ingredients

Chia pudding 67% (organic* SOYA drink 85,5% (water, organic* SOYA beans 7%, organic* apple concentrate 3%, organic* lithothamnium calcareum seaweed, sea salt), chia seeds 11%, sugar 3%), puree of pear and parsnip 28% (pear 67%, parsnip 20%, honey 9%, lemon juice 1%), turmeric, raisins 4% (grape, cottonseed oil). *64,4% of the ingredients are sourced from organic farming. Certified by Certisys BE-BIO-01

Allergens

  • Soya

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 137kcal
    7%
  • Total fat 5g
    7%
  • Saturated fatty acids 1g
    3%
  • Glucid 18g
    7%
  • Sugar 12g
    14%
  • Protein 4g
    9%
  • Salt 0g
    2%
  • FA 4g
    16%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.