celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Mousses

Tiramisu

Tiramisu

Ingredients

Fresh CREAM MASCARPONE (CREAM, hydrated whole MILK, sugar, EGG yolk, salt, alimentary acid: citric acid, gel agent: pectin, modified starch (corn)), fresh CREAM 40% (CREAM, gel agent: carrageenan), boudoir cookies (sugar, WHEAT flour, whole EGGS, glucose-frucose sirup, ammonium carbonate, MILK protein, flavouring, alimentary acid: citric acid), water, sugar, cocao powder, amaretto (water, sugar, alcohol, flavouring), coffee essence (coffee, water, sugar), coffee.

Allergens

  • Eggs
  • Gluten
  • Milk

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 313kcal
    16%
  • Total fat 24g
    34%
  • Saturated fatty acids 15g
    75%
  • Glucid 19g
    7%
  • Sugar 15g
    17%
  • Protein 3g
    6%
  • Salt 0g
    2%
  • FA 1g
    3%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Vegetarian recipes

Our vegetarian dishes are prepared without meat or fish but may contain dairy, eggs, or traditional rennet cheeses. We use seasonal vegetables, grown locally, naturally rich in vitamins and nutrients. You find these recipes easily thanks to the light green "Veggie" pictogram.