celerycrustaceanseggsfishglutenlupinemilkmolluscmustardnutspeanutsesamesoyasulphitesarrow-downarrow-rightarrow-right-shortblockquote-brblockquote-tlblockquoteline-scratchedlinelineload-more-down200420072014anti-gaspillageAssistant Manbien-êtrebien mangerbien-êtreboissons-chaudesboissons-froidescartecelerycommunautecontactconvivialitecrustaceansdurableeggsepicerie v2europe-USAeurope-USA copiefairtradefaqfishfraisfranchiseglutengreencardjobslegume-moisles-plats-chauds v2lupineManagermatinmenumidimilkmodifier_profilmolluscmon-ekilibremon-exkimustardnaturelnewsnutspeanutpetit-dejPlan de travail 133Plan de travail 134Plan de travail 135pretrecettes-aux-fruitsrecettesrespectrestaurantsrichessesaladessandiwiches v4sesamesoirsoyasulphitesvaleurs v2viennoiseries-tartes v3visionaddressbabieschilddisabledeveninghelpkids-friendlymailmarkermon-exkiopeningphonepressterracetrashveganvegewifizoomfacebookinstagramtwitter
Pies

Almond - Orange

Almond - Orange

Ingredients

Orange juice 20%, sugar, EGG, ALMOND 10%, BUTTER, margarine, polenta, backing powder, icing, orange zest, flavouring.

Allergens

  • Eggs
  • Milk
  • Nuts

Nutrient inputs

Recommended dietary allowance (%)

  • Energy 491kcal
    25%
  • Total fat 34g
    49%
  • Saturated fatty acids 13g
    63%
  • Glucid 31g
    12%
  • Sugar 28g
    32%
  • Protein 10g
    20%
  • Salt 0g
    5%
  • FA 6g
    24%
Add to my Ekilibre

Daily Caloric Needs

Right you will find the product composition in relation to the recommended daily intake. You can add the product to my EXKi and see its nutrient values as part of an actual meal.

What is a calories intake?

Reference intakes (RIs) are the reference values defined by law for a balanced diet. These values indicate the daily recommended intake of energy, nutrients, vitamins and minerals for an average adult to ensure a healthy diet.

Learn more about my Ekilibre

Additional information

Gluten free recipes

Our recipes are made from gluten-free ingredients. However, traces of gluten may remain in certain preparations following preparation in our kitchens of other products with gluten. EXKi offers a wide range of dishes, hot and cold, labelled 'gluten-free', and indicated by the symbol of a crossed-out wheat sheaf.